Protein Info for AMB_RS21860 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 893 PF08447: PAS_3" amino acids 102 to 184 (83 residues), 32.6 bits, see alignment E=2.7e-11 amino acids 350 to 434 (85 residues), 30.7 bits, see alignment E=1.1e-10 TIGR00229: PAS domain S-box protein" amino acids 194 to 317 (124 residues), 76.3 bits, see alignment E=2.4e-25 amino acids 318 to 448 (131 residues), 36.6 bits, see alignment E=4.3e-13 PF13188: PAS_8" amino acids 197 to 251 (55 residues), 21.8 bits, see alignment 4.7e-08 PF00989: PAS" amino acids 198 to 307 (110 residues), 46.2 bits, see alignment E=1.5e-15 PF08448: PAS_4" amino acids 203 to 311 (109 residues), 34.9 bits, see alignment E=5.6e-12 PF13426: PAS_9" amino acids 207 to 309 (103 residues), 45.1 bits, see alignment E=3.7e-15 amino acids 348 to 440 (93 residues), 16.4 bits, see alignment E=3.3e-06 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 449 to 612 (164 residues), 101.6 bits, see alignment E=4e-33 PF00990: GGDEF" amino acids 452 to 606 (155 residues), 124.1 bits, see alignment E=1.7e-39 PF00563: EAL" amino acids 630 to 865 (236 residues), 252.2 bits, see alignment E=1.6e-78

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4321)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ50 at UniProt or InterPro

Protein Sequence (893 amino acids)

>AMB_RS21860 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MVLTAAKSPDTIERVDDFHYSRPQPGKESRVKSSTNSGNEQGASATQASAGLAGGAPCAP
SEALPRLVEAEARLDGLTANLPGFAFQRSLGTDGTIHYPWFSPSIRSVLGFAVESMGVNS
QGCLHAVHWADRDTHLAEIRRSAAQMDTCREEFRAISAHGEVRWLKGASEPRRQEDGSVI
WDGVMVDVTDGRRAELRLEMLMDHAGDSLIVVGSDGTIDSVNAAAEALFGWASSELVGKP
FTTLLPQSLHLDDLLESAEVSAGGIVGGGARELMGLRKDGSTFPLELSTTEVRLEGQRLF
IGIGRDITERKLTEAALRESEERLRAIAANVPGMVFQRELHPDGSLCFSYVSEGCRAILG
LGPEQLIDNPQLFLSLIPEDERSGFYAGLGRSARSMEPFDEEMAVPGSDGRRRWLRGQSR
PTLRGDGNVVWDGVMLDVTDSKHAEQRLSFLAYFDPLTRLPNRTAFLERFAAAREIAARD
QTMLAVVSVGLDRLGIINATMGHSIGDQVLMAAGDLLRAALSSNDVIARTSGDRFLVLIT
GLGSKREAMEALERLRASAHATVAAAGQDFDVSAAMGAAVYPRDGDDAETLIKNADAALQ
LAKVQGPATLQVFTKEISARAAKTLSLQTRLRRAIDQGELIAHYQPQVDLRNGDVVGMEA
LVRWNSPDLGMVSPADFIPVAEESGLIDGVCEFMLWECTRQNKQWQDEGLPPIPVAVNVS
GRQFQYARRLLSACERALVDNRLDSRWLEVELTESSAMRDADNAIAVVNQLKEMGIACSI
DDFGTGYSSLSVLKRFPISKLKIDRSFVLDVTTDPNDAAIVDAIIAMAKALRLKVVAEGV
EHQEHLDFLRNLGCDQMQGYFFSRPLPADGMRALLAEGRRLHMTEATLHSVTA