Protein Info for AMB_RS21855 in Magnetospirillum magneticum AMB-1

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details PF03741: TerC" amino acids 19 to 215 (197 residues), 138.4 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4320)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ51 at UniProt or InterPro

Protein Sequence (258 amino acids)

>AMB_RS21855 TerC family protein (Magnetospirillum magneticum AMB-1)
MSMTMAWISDPEIWISLATLALLEIVLGIDNLVYLAIISNRLPERLRPLGRRLGLAFAVV
TRLGLLASLSWIVGLVEPVFVVWDHPVSWRDIILIGGGTFLVAKATHEIHGSLEGEEETA
GAVGEDGAAGKAVEAGLASVVVQIAVLDIVFSLDSVITAVGMARDLGVMVAAVILASAVM
VVAANPLSALIARHPTIKMLALSFLLLIGATLVADGTGFHMPKGYIYFAMAFSLGIEILN
LLARRGKRAPVKLRTPVP