Protein Info for AMB_RS21830 in Magnetospirillum magneticum AMB-1

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 15 to 173 (159 residues), 55.5 bits, E=4.1e-19

Best Hits

Swiss-Prot: 64% identical to Y1060_BURL3: Putative NADH dehydrogenase/NAD(P)H nitroreductase Bcep18194_B1060 (Bcep18194_B1060) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 66% identity to bpy:Bphyt_4806)

MetaCyc: 58% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• glyoxylate assimilation (9/13 steps found)
• β-alanine degradation III (1/2 steps found)
• uracil degradation III (3/5 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.298

Protein Sequence (196 amino acids)

>AMB_RS21830 malonic semialdehyde reductase (Magnetospirillum magneticum AMB-1)
MSDILDPTALDRLFRQARTHSKFKETPVPDALLRQAWDLARMGPTSVNCQPMRVVFVRSA
EAKQRLKPALAPGNLDKTMAAPVTAIIAHDMEFYEKLPKLFPHTDARAWFVGNEAMIQST
AFRNGTLQGGYFILALRAVGLDSGAMSGFDNAKVDEAFFAGTSLRSNFLINIGYDDESGL
FPRGPRLEFDEACRVE