Protein Info for AMB_RS21550 in Magnetospirillum magneticum AMB-1

Annotation: cytidylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00017: cytidylate kinase" amino acids 2 to 201 (200 residues), 180.9 bits, see alignment E=1.4e-57 PF13189: Cytidylate_kin2" amino acids 4 to 147 (144 residues), 31.4 bits, see alignment E=2.2e-11 PF02224: Cytidylate_kin" amino acids 5 to 203 (199 residues), 193.4 bits, see alignment E=4.2e-61

Best Hits

Swiss-Prot: 100% identical to KCY_MAGSA: Cytidylate kinase (cmk) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 100% identity to mag:amb4262)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.25

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZA9 at UniProt or InterPro

Protein Sequence (211 amino acids)

>AMB_RS21550 cytidylate kinase (Magnetospirillum magneticum AMB-1)
MSTIIAIDGPAAAGKGTLARRLAAELGFDYLDTGLIYRAVGMKLARAGLDPADVALAERA
ARQLSPDDLAATDLRIDEAAQAASKVASIPGVRAALLDFQRRFAATPPGGKGAVLDGRDI
GTVVCPEAQVKLFVTASVEKRAERRLKELQEKGLGAIYGTVLADMRERDERDTNRAVAPL
VPAQDAAVLDTSDLDADQAFAAALGIIGSKR