Protein Info for AMB_RS21485 in Magnetospirillum magneticum AMB-1

Annotation: tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF02899: Phage_int_SAM_1" amino acids 18 to 104 (87 residues), 59.5 bits, see alignment E=3.2e-20 PF00589: Phage_integrase" amino acids 150 to 299 (150 residues), 122.9 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 53% identical to XERC_RHOCS: Tyrosine recombinase XerC (xerC) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to mag:amb4250)

Predicted SEED Role

"Site-specific tyrosine recombinase" in subsystem Proteasome bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZC1 at UniProt or InterPro

Protein Sequence (314 amino acids)

>AMB_RS21485 tyrosine recombinase XerC (Magnetospirillum magneticum AMB-1)
MPPSPIHFAAKADLARAVESWWQWLGSERRASSHTLDGYGRDLAAFLTFLTEHLAAEPDL
AALASLGAGDFRAFLARRTQDGLGRSSLARLMSTLRGFFKFLDRHDLVHNPALKAVKSPR
PPKSVPKPLAPDEALEALSSAGELHDEPWLAARDVALFTLLYGAGLRLGEALSLTRRDLP
KGDTMVITGKGNKQRVVPVLPVVRDAIADYLKRLPYPAEPTDPIFLGARGGPLNPGVVQR
QMRRLRQMMGLPETATPHALRHSFATHLLAGGGDLRTIQELLGHSSLSTTQRYTEVDAAR
LTRVYRDAHPRAKA