Protein Info for AMB_RS21455 in Magnetospirillum magneticum AMB-1

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF13560: HTH_31" amino acids 9 to 66 (58 residues), 48.1 bits, see alignment 3.4e-16 PF12844: HTH_19" amino acids 10 to 68 (59 residues), 36.9 bits, see alignment E=9.2e-13 PF13443: HTH_26" amino acids 12 to 71 (60 residues), 24.4 bits, see alignment E=8.4e-09 PF01381: HTH_3" amino acids 13 to 66 (54 residues), 52.7 bits, see alignment 1e-17 PF06114: Peptidase_M78" amino acids 195 to 316 (122 residues), 73.4 bits, see alignment E=4.4e-24 PF09856: ScfRs" amino acids 317 to 473 (157 residues), 241.2 bits, see alignment E=1.4e-75

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 100% identity to mag:amb4244)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZC7 at UniProt or InterPro

Protein Sequence (476 amino acids)

>AMB_RS21455 XRE family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MAMNKKLFLGYKLRRLREGKKLSQAALAVLLEVSPSYLNQIENNQRPLTVPVLLRIAKVL
DVDLATLVEDEESRLVADLREALNDPVFGSGSIGLSELRNAASASPELAKRVLTLYQTFR
QLDERMQSLTENLSSATGEERGGHAHFPYEEVRDFFYYCNNYFGPLDEAAEALVEEEGFR
LGQMHNDLVAYLENRHGVRVRIVAEDDTAGMRTFEPGAGSLSLSALLSVPSRTFQLAHQV
ALLAYHERIEEVVAGAKLSSDDARSICRVGLANYFAGALVMPYMAFANQAKALRHDIEQL
QSRFGASFEQVAHRLSTLQRPGARGVPFYFVRVDMAGNITKRHSATRFHFTRFGGACPLW
NVHEAFAQPGKILVQLARMPDSISYICVARTVSKRGGSYLRPDRQFAVGLGCETAYASEV
VYSAGLDLASEQAAVPIGVNCRICERDDCRQRAFPPIGSHISVDENNRSFVPYLFA