Protein Info for AMB_RS21450 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA carboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01039: Carboxyl_trans
  • amino acids 27 to 510 (484 residues), 681.7 bits, E=2.9e-209

Best Hits

Swiss-Prot: 76% identical to PCCB_RHOS4: Propionyl-CoA carboxylase beta chain (pccB) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01966, propionyl-CoA carboxylase beta chain [EC: 6.4.1.3] (inferred from 100% identity to mag:amb4243)

MetaCyc: 76% identical to propionyl-CoA carboxylase beta subunit (Cereibacter sphaeroides)
Propionyl-CoA carboxylase. [EC: 6.4.1.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• methylaspartate cycle (14/19 steps found)
• superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
• propanoyl CoA degradation I (2/3 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• 2-oxobutanoate degradation I (2/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.3

Use Curated BLAST to search for 6.4.1.3

Sequence Analysis Tools

See Q2VZC8 at UniProt or InterPro

Protein Sequence (512 amino acids)

>AMB_RS21450 acyl-CoA carboxylase subunit beta (Magnetospirillum magneticum AMB-1)
MHEIIQQLEEKREGARMGGGEKRIAAQHKRGKLTARERIELLLDPDSFEEWDMFKEHRCT
DFGMDSEDNMIPGDGVVTGYGTINGRLVFVFSQDFTVFGGSLSEAHAEKICKIMDKAVQV
GAPVIGLNDSGGARIQEGVASLAGYAEVFQRNVMASGVVPQISMIMGPCAGGAVYSPAMT
DYIFMVKDSSYMFVTGPDVVKTVTHETVTAEELGGAVTHSTKSGVADLAFENDVEALLQL
RRFMDFLPSSNREKPPVRPTSDGPERIETSLDTLIPDNANKPYDMKELILKVVDEGDFFE
VQPGYAGNIIVGFARMEGRTVGIVANQPMVLAGCLDISSSIKGARFVRFCDAFNIPIVTF
VDVPGFLPGTSQEYGGIIKHGAKLLYAYAECTVPKITVITRKAYGGAYDVMSSKHLRGDV
NFAWPTAEIAVMGPKGAVEIIFRSDIGDAEKIAARTEEYRQKFANPFIAGHRGFIDDVIM
PRNTRKRICRSLAMLKDKDVKNPWRKHGNIPL