Protein Info for AMB_RS21280 in Magnetospirillum magneticum AMB-1

Annotation: TVP38/TMEM64 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 73 to 189 (117 residues), 72.5 bits, see alignment E=2.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4206)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZG5 at UniProt or InterPro

Protein Sequence (246 amino acids)

>AMB_RS21280 TVP38/TMEM64 family protein (Magnetospirillum magneticum AMB-1)
MTAKGHHPLLNPRAMVKGLVLIATLVMIGFLLEGLGLKDALDTHWIDAEVKGKGLSGDAL
FVIIGALAVCIGLPRQGVCFLAGYAFGFAEGLVWSSLASMVGCIMTFFYARQMGRSFVTS
RFPERVARIDAFLAGNAFAMTLLIRLLPVGSNVITNLAAGVSGARPIPFFLGSLLGYLPQ
TVVFALLGSGIQVDPVFRIGASVVLFVASGVMGVWLFRRFRHGRHLDAATEAVIEEDGDE
PNEQAR