Protein Info for AMB_RS21260 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c-type biogenesis protein CcmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 57 (57 residues), see Phobius details transmembrane" amino acids 140 to 161 (22 residues), see Phobius details PF03918: CcmH" amino acids 45 to 188 (144 residues), 180.5 bits, see alignment E=5.3e-58

Best Hits

Swiss-Prot: 52% identical to CCMH_BRADU: Cytochrome c-type biogenesis protein CcmH (ccmH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to mag:amb4202)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZG9 at UniProt or InterPro

Protein Sequence (193 amino acids)

>AMB_RS21260 cytochrome c-type biogenesis protein CcmH (Magnetospirillum magneticum AMB-1)
MTSIRHPEHREGSPPGSSRPARHEWSRMGSLGFARDDRRIGAALVALLLLSTPALAVNPD
EMLKDPAQEHRARELGKDLRCLVCQNQSIDDSDADLAKDLRVIVRERIAKGDSDDQVRAF
VVDRYGDYVLLKPPFKATTLALWLGPLGLFLGAVWAVLAFYRRRPGEKTTPPPPPLSAEE
QRKLDKLLKESER