Protein Info for AMB_RS21250 in Magnetospirillum magneticum AMB-1

Annotation: heme lyase CcmF/NrfE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 449 to 471 (23 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details amino acids 621 to 640 (20 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 645 (593 residues), 683.7 bits, see alignment E=1.4e-209 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 179.6 bits, see alignment E=6.6e-57 PF16327: CcmF_C" amino acids 315 to 642 (328 residues), 397.9 bits, see alignment E=3.5e-123

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 100% identity to mag:amb4200)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZH1 at UniProt or InterPro

Protein Sequence (659 amino acids)

>AMB_RS21250 heme lyase CcmF/NrfE family subunit (Magnetospirillum magneticum AMB-1)
MIAEIGHFALVLALCVALVQAVVPLVGAKRGNLAWMNVAGPAATLQFLFIAMAFGALTNA
YVTSDFSVMNVAQNSHTDKPMLYKVAGVWGNHEGSLLLWITILSLFGFAVTLFGRNLPPG
LKSRALAVQAMIAVGFLAFILLTSNPFARLDPAPVNGQGLNPMLQDPGLAFHPPFLYLGY
VGFSMAFSFAIAALLEGRVDAAWARWVRPWTLAAWVFLTCGIVLGSWWAYYTLGWGGWWY
WDPVENASFMPWLAGTALLHSAIVVEKRDALKSWTILLAIVAFGLSLLGTFLVRSGVLTS
VHAFATDPARGVFILLLLCGAVGGSLALYAARAPSMKMGGLFSPISREGALLLNNVLMAT
GAATVLLGTLYPLIADALNLGKVSVGPPFFNAVFLPLMAPMVLVMAAAPMMSWKRGDLAG
VLGRLKFIGALALGAAMLVWFLQGGSAGPWWTAAGFALAVWLGLGTLWDLAERIGLFSRP
GQALARAAKLPNSAWGMVLAHFGLAVFIVGLTASSAWTTERIQTQKLGETVTVAGYGITL
KAVDEVPGPNYTATRATFEISKGGQAIAVMQPEKRLYRQPPRPTTTAAIRSGFTGDLYVV
IGDPDPNKGGWVTRLYFNPCIPWLWAGGLLLVIGGTISLADRRHRVGAPTRAASAAAKA