Protein Info for AMB_RS21225 in Magnetospirillum magneticum AMB-1

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00111: Fer2" amino acids 5 to 62 (58 residues), 35.8 bits, see alignment E=9.7e-13 PF13085: Fer2_3" amino acids 13 to 70 (58 residues), 34.6 bits, see alignment E=2.4e-12 PF01799: Fer2_2" amino acids 72 to 144 (73 residues), 90.6 bits, see alignment E=8.8e-30

Best Hits

Swiss-Prot: 51% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 61% identity to hch:HCH_05037)

MetaCyc: 51% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>AMB_RS21225 (2Fe-2S)-binding protein (Magnetospirillum magneticum AMB-1)
MFSLIINGERHKVDAAPDTPLLWVLRDLLSMTSIRYGCGQGLCGACSILVDGEPTRACQT
PVSEINGRRIQTLAGLGDAVSAQLRAAWIELDVPQCGYCQSGQLISAGALLRRNPNPSDG
DIDTAMSGNLCRCGTYQRIRAAIHLAARRLRGAS