Protein Info for AMB_RS21105 in Magnetospirillum magneticum AMB-1

Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR01083: endonuclease III" amino acids 24 to 212 (189 residues), 260.4 bits, see alignment E=4.4e-82 PF00730: HhH-GPD" amino acids 52 to 186 (135 residues), 80.4 bits, see alignment E=1.9e-26 PF00633: HHH" amino acids 118 to 145 (28 residues), 30.8 bits, see alignment (E = 2.7e-11) PF10576: EndIII_4Fe-2S" amino acids 205 to 221 (17 residues), 21.6 bits, see alignment (E = 3.2e-08)

Best Hits

Swiss-Prot: 62% identical to END3_ECOLI: Endonuclease III (nth) from Escherichia coli (strain K12)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 100% identity to mag:amb4170)

MetaCyc: 62% identical to endonuclease III (Escherichia coli K-12 substr. MG1655)
DNA-(apurinic or apyrimidinic site) lyase. [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZK1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AMB_RS21105 endonuclease III (Magnetospirillum magneticum AMB-1)
MRGGRPASSCGGAGGSQPMTPKQADRFYALLAERNPEPKSDLEYADPYTLLVAVVLSAQA
TDAGVNKATRPLFARVNTPQAMVELGEEGLVQSIRTIGLYKTKAKNVIELSRRLLSLHGG
QVPHDRAALEALPGVGRKTANVVLNIAFGEPTIAVDTHCFRVANRTGLAPGKTVEAVEQG
LMKATPAKWLQHAHHWLILHGRYTCKARKPDCAACVVRELCAFDGKETV