Protein Info for AMB_RS21030 in Magnetospirillum magneticum AMB-1

Annotation: metalloprotease TldD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF01523: PmbA_TldD_1st" amino acids 37 to 92 (56 residues), 47 bits, see alignment 3.6e-16 PF19290: PmbA_TldD_2nd" amino acids 124 to 233 (110 residues), 71.5 bits, see alignment E=1.3e-23 PF19289: PmbA_TldD_3rd" amino acids 241 to 474 (234 residues), 225.2 bits, see alignment E=8.6e-71

Best Hits

KEGG orthology group: K03568, TldD protein (inferred from 70% identity to azl:AZL_012260)

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>AMB_RS21030 metalloprotease TldD (Magnetospirillum magneticum AMB-1)
MSNLAVAQDLFFTQTGLDADGLRRIVAEALTGADDGELFLEYRQSESLVLDDGQIKSASF
DTTQGFGLRAVAGEAHGYAHGSDLSAEAIRRASATVRAVRSGHSGTMAQAPAGGAKPLYT
GINPLAQVPFEDKVRLLEEIDSYTRSRDNRVRQVTASLAGSWQAVTILRADGTLAADIRP
MVRLGVNVVLGDGDRMETGGHGMGGRIGYGGVMGLADWQHCADEALRQASVNLGSIPAPA
GEMPVVLGPGWPGVMLHEAVGHGLEGDFNRKATSAFTGKIGTRVASPGVTVIDDGTIPDR
RGSLSIDDEGTPTSRTVLIEDGILVGYLQDRMNARLMGVAATGNGRRQSYAHAPIPRMTN
TFMMAGDKDPAEIIASVPRGIYAVNFGGGQVDITNGKFVFSASEAYLIENGKVGPAVKGA
TLIGNGPDAMTRVTMIGTDLALDPGIGTCGKDGQGVPVGVGQPTLRMDGLTVGGTAV