Protein Info for AMB_RS20960 in Magnetospirillum magneticum AMB-1

Annotation: two-component system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 87.9 bits, see alignment E=8e-29 PF01966: HD" amino acids 174 to 310 (137 residues), 59.7 bits, see alignment E=5e-20 PF13487: HD_5" amino acids 207 to 342 (136 residues), 106.6 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 52% identical to CDPD2_PSEAE: Cyclic di-GMP phosphodiesterase PA4781 (PA4781) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 100% identity to mag:amb4144)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZM7 at UniProt or InterPro

Protein Sequence (381 amino acids)

>AMB_RS20960 two-component system response regulator (Magnetospirillum magneticum AMB-1)
MSDDIRPTILVVDDTPDNLKLMSGLLKDLYRVKIANGGEKALAIAASDAPPDLILLDIMM
PEVDGYEVCRRLKASRATRDIPVIFLTAMSGSEDEEVGLKMGAVDYITKPITPAVVLARV
ETHLKLKASADFLRDKTAYLETEVTRRTRELAAIQDVTILAMASLAETRDSDTGNHIRRT
QYYVRALALKLRDHPRFSSSLDDGVVDMLFKSAPLHDIGKVGIPDRILLKPGRFEPAEFE
IMKTHTTLGRDAIEHAEQSLGTPVAFLSMAKEIAYAHQEKWDGSGYPRGIGGDDIPVSAR
LMAVADVYDALISRRVYKEGMPHATAVQIIREGSGSHFDPDIVEAFLALEDEFKAIAARF
ADSDGDMEKKKEYLSRAGGVP