Protein Info for AMB_RS20900 in Magnetospirillum magneticum AMB-1

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 936 PF01565: FAD_binding_4" amino acids 45 to 182 (138 residues), 109 bits, see alignment E=7.3e-35 PF02913: FAD-oxidase_C" amino acids 270 to 517 (248 residues), 202.1 bits, see alignment E=5.7e-63 PF13183: Fer4_8" amino acids 541 to 612 (72 residues), 44.1 bits, see alignment 1.1e-14 PF12838: Fer4_7" amino acids 543 to 612 (70 residues), 38.5 bits, see alignment 5.9e-13 PF13187: Fer4_9" amino acids 544 to 611 (68 residues), 27.8 bits, see alignment 9.3e-10 PF13534: Fer4_17" amino acids 544 to 612 (69 residues), 36 bits, see alignment 3.7e-12 PF02754: CCG" amino acids 707 to 802 (96 residues), 20.7 bits, see alignment E=1.6e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4132)

Predicted SEED Role

"Predicted D-lactate dehydrogenase, Fe-S protein, FAD/FMN-containing" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZN9 at UniProt or InterPro

Protein Sequence (936 amino acids)

>AMB_RS20900 FAD-binding oxidoreductase (Magnetospirillum magneticum AMB-1)
MTRTAPDYSALLQDLTGVMPVSRLITDPLRRLAYGTDASFYRLVPQVVAEVRDEAEVKGV
LAACRRHGAPVTFRAAGTSLSGQAVSDSVLMILGTGWTQAVVEDEGKRIRLQPGVIGAEA
NRRLAAFARKIGPDPASIDSCKIGGIAANNASGMCCGTSDNSYQTVMSMRLVLADGTLVD
TGNPESVAAFRASHAELLSRLDDMGRRVRDDETLAGRIRHKFAIKNTTGYSLNALVDFTD
PLDILTHLMIGSEGTLGFIAEITYRTVPEHAHKASALLLFPDIAEACRAVVALKQAPVSA
VELMDRASLRCVEDKPGMPAQIRGLADGVTSLLVEARGETAEALAANLAEIGRVLSGVTT
LFPPAFTDDPYEYGTLWKIRKGLFPALGAVRKVGTTVIIEDVAFPIESLAAATTDLEHLC
RKHGYDEAIIFGHALDGNLHFTFTQDFGIKEEVDRYARFMDEVAELVVNKYDGSLKAEHG
TGRNMAPFVEMEWGTEATALMWDIKGLLDPLGLLNPGVLLDKDPRAHLNNLKPLPAADSL
VDTCIECGFCERMCPSHGLTLSPRQRITSWREISRRTAANENSDELRRLYDYQGIDTCAA
CGLCATACPVGIETGRLTKSLRGRRLGSGAHAVGQWASRHYGAAMAATRFGLGAAALVSR
LAGPSAMAAMASGLRTLSGGRTPKLGEHLPTAADFAPPANAPSGERVVYFPTCAARTMGP
ASGDPEKDSLPTVMTRVLARAGFGVVIPDGVENLCCGQAFESKGLQATADAKAAELEAAL
FKASDHGRLPIVMDASACAWRMKTYLGERLKVVDSVEFLHDAALPRLSPTPQDAPVLVHV
NCGARKQGLDDKMVGLAKACAKTAIVPEAVGCCGFAGDKGFTNPELNDHALRHLAPQVPQ
GCEAGYSSNRTCEIGLADHADVPYRSIVYLLDRTTR