Protein Info for AMB_RS20885 in Magnetospirillum magneticum AMB-1

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 10 to 91 (82 residues), 51.4 bits, E=4.9e-18
  • amino acids 138 to 222 (85 residues), 59.5 bits, E=1.4e-20

Best Hits

Swiss-Prot: 46% identical to LUTA_GEOKA: Lactate utilization protein A (lutA) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K00104, glycolate oxidase [EC: 1.1.3.15] (inferred from 100% identity to mag:amb4129)

MetaCyc: 44% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• photorespiration I (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• superpathway of glucose and xylose degradation (11/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• heterolactic fermentation (10/18 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27 or 1.1.3.15

Sequence Analysis Tools

See Q2VZP2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>AMB_RS20885 (Fe-S)-binding protein (Magnetospirillum magneticum AMB-1)
MPKQPRPESVYFFGTCLIDLFYPEAGLAGMELLQREGLKVVFPPNQTCCGQPARNNGYQD
EARKVARLQMDSFPGDWPIVVPSGSCAGMMKTHYPEMFEGTPDHDRAVAFSARVYELTEF
LVDVLGVKLVDKGQKVTITWHPSCHSQREAGVVEQPKALLRQLTNVTLVENPREKECCGF
GGAFAVRQAEISAAMVTDKVASIEETGATQVVSGDCGCLMNITGAAEKAAKGFKGRHIAE
FILERCHGR