Protein Info for AMB_RS20870 in Magnetospirillum magneticum AMB-1

Annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 6 to 218 (213 residues), 207.5 bits, E=2.4e-65
• PF00117: GATase
  • amino acids 91 to 233 (143 residues), 59.7 bits, E=3.2e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4127)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• 4-aminobenzoate biosynthesis I (1/2 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of tetrahydrofolate biosynthesis (6/10 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See Q2VZP4 at UniProt or InterPro

Protein Sequence (237 amino acids)

>AMB_RS20870 gamma-glutamyl-gamma-aminobutyrate hydrolase (Magnetospirillum magneticum AMB-1)
MSFSPPLIGITLDSEEPGGYSRMPWYALRRNYAETVARAGGLPVLLPHEPRLAASFLDRI
DGLVVTGGAFDIDPALFGAEARAGLVLKRGRTEFELAMVRGALERDMPILGICGGQQLLN
VALGGTLIQHIPDEVNGALSHEQPTPRSEPGHWVEIASGTRLAEIVGETRIPVNSAHHQA
VRMVAPGCVVNAIAPDGVIEGIEAAGRTFCIGVQWHPEYDISPADSALLRAFVGACR