Protein Info for AMB_RS20820 in Magnetospirillum magneticum AMB-1

Annotation: polyribonucleotide nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 13 to 693 (681 residues), 1061.4 bits, see alignment E=0 PF01138: RNase_PH" amino acids 15 to 146 (132 residues), 117.8 bits, see alignment E=1.1e-37 amino acids 325 to 457 (133 residues), 100.6 bits, see alignment E=2.3e-32 PF03725: RNase_PH_C" amino acids 149 to 212 (64 residues), 35.7 bits, see alignment E=1.7e-12 PF03726: PNPase" amino acids 256 to 321 (66 residues), 53.1 bits, see alignment E=9e-18 PF00013: KH_1" amino acids 557 to 614 (58 residues), 47 bits, see alignment 4.3e-16 PF00575: S1" amino acids 619 to 691 (73 residues), 60.1 bits, see alignment E=5.7e-20

Best Hits

Swiss-Prot: 100% identical to PNP_MAGSA: Polyribonucleotide nucleotidyltransferase (pnp) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 100% identity to mag:amb4117)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZQ4 at UniProt or InterPro

Protein Sequence (720 amino acids)

>AMB_RS20820 polyribonucleotide nucleotidyltransferase (Magnetospirillum magneticum AMB-1)
MSMFNVHRKEITWGGRKLVLETGKVARQADGAVMVTYGETSVLCTVVGAKSQKPGIDFFP
LTVNYQEKAFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFADGFRNEVQVVCTVL
SHDLENDPDIAALVGTSAALTISGLPFMGPVGAARVGYVDGAYVLNPLVGDLPKSELDLV
VAGTVEGVLMVESEAKQLSEDVMLGAVMFGHREFQAVIQAIIDLAEECAKDPWDLPEPPA
EVAVVTGKFNDAGVPAELAEAYKIIKKQDRYAAVGAVKKKALALLTEAAEIAVAGGILKH
LEADVVRGNILKTGVRIDGRDTKTVRAIEVEVGVLPRAHGSALFTRGETQALVVATLGTG
QDEQIIDQLAGEYREHFMLHYNFPPYSVGEAGRMGSPGRREIGHGKLAWRAMRPCLPAKE
SFPYTMRVVSEITESNGSSSMASVCGSSLALMDAGVPLPKPVAGIAMGLIKEGTDFAVLS
DILGDEDHLGDMDFKVAGTVDGVTALQMDIKITSITEEIMKIALGQAKDGRIHILGEMNK
GLDHARDSVSGNAPRITTISIPKEKIREVIGTGGKVIREICEQTGAKIDIDDDGTIKVAS
VDADAAQRAIDWIRGIVAEPELGVIYNGKVVKVVDFGAFVNFLGSRDGLVHISELARERV
AKTADVVKQGDVVKVKVLGFDDRGKVKLSMKQVDQTTGEDISAQLEAERAASKRERHHED