Protein Info for AMB_RS20775 in Magnetospirillum magneticum AMB-1

Annotation: TrkH family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 389 to 415 (27 residues), see Phobius details amino acids 454 to 480 (27 residues), see Phobius details PF02386: TrkH" amino acids 69 to 477 (409 residues), 160.2 bits, see alignment E=3.4e-51

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to mag:amb4109)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZR2 at UniProt or InterPro

Protein Sequence (482 amino acids)

>AMB_RS20775 TrkH family potassium uptake protein (Magnetospirillum magneticum AMB-1)
MIDLRPVLSIVGALVCILAAAMWLPAAIDFRDGHEEWRVFATSSGLTLFFGLALLLGTRL
PQQRRSVRQTYLAATFGLAVPALFAALPLVYGPLQLSFVDAAFEATAGLTTSSATVIRGL
DVLPRGLLLWRALLGWLGGIGVIALAIAVLPDLAVGGMQMFRVEVPGPAERATSRGRRIA
ASILAGYCGATGLLALALWLAGMSGFEALVHAMGTISTSGASTSDASIGHFDSGAITVLI
TFGMVLGGMPFLLFFHFLRGNRKVVLRDHQLRWYFALLTLGTLGVSAWLVSSRGLAPLDA
LRHGALTVVSVMTGTGHFTLEYGNWGGMPAAILFFLAFVGGCAGSTSGGIKVFRFQFLFA
DALMQIRRLLRPHAVLIATFNRRPIPEGVLGSVMGFLFVYALSFAMLSMSLAFLGLDFVT
AVSGAASALANLGPGLGPEIGPGGSYAGLPDLAKGLLCLGMLVGRLELFTVLVLFVPAFW
RQ