Protein Info for AMB_RS20745 in Magnetospirillum magneticum AMB-1

Annotation: DNA polymerase III subunit gamma/tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 10 to 370 (361 residues), 435.5 bits, see alignment E=8.4e-135 PF13177: DNA_pol3_delta2" amino acids 27 to 190 (164 residues), 130.1 bits, see alignment E=2.7e-41 PF00004: AAA" amino acids 49 to 184 (136 residues), 39.1 bits, see alignment E=3.6e-13 PF22608: DNAX_ATPase_lid" amino acids 196 to 242 (47 residues), 68.1 bits, see alignment 1.6e-22 PF12169: DNA_pol3_gamma3" amino acids 244 to 386 (143 residues), 186.2 bits, see alignment E=9.8e-59 PF12362: DUF3646" amino acids 451 to 564 (114 residues), 114.5 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 100% identity to mag:amb4103)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZR8 at UniProt or InterPro

Protein Sequence (596 amino acids)

>AMB_RS20745 DNA polymerase III subunit gamma/tau (Magnetospirillum magneticum AMB-1)
MSDTPAPTPYRVLARKYRPTDFAGLIGQEAMVRTLSNAIKTGRLAHAFVLTGVRGVGKTT
TARIIARALNCVGLDGKGGPTIDPCGQCEHCRAIAEDRHVDILEMDAASRTGVNDIREII
EGVRYRPTSARFKIYIIDEVHMLSTAAFNALLKTLEEPPEHVKFVFATTEIRKIPVTVLS
RCQRFDLRRVEMEVLAKHFESIAAKEQAEIEPAALKLIARAADGSVRDGLSLLDQAISHG
AGAVTEAQVRDMLGLADRARVFDLLDAIMKGQVPAALDQITDQYAAGADPVVVLQDMLEL
VHWLTRLKVTPDAADQLGASETERVKGAEMSKTLSLAALTRAWQMLLKGLGETRNAPNPL
QAAEMAVVRLAYAAELPSPAELVEQLRANPPPPPAPRGPGGGGSGGGFGGGGADAVSNHH
MGGGPVHGPATALKLQPAPVAETVTLPAMPPDFAAVVALFTERREGLIAVQLRTQVNLVS
FAAGRIEWRQNSGVGSDLAPKTARLLSEWTGRRWTVSVNSTDSAQPTLAEQEANAELRRR
ADAAELPLVKAVLAAFPGATIEAVRDLGAEELPDAPPPEDPEAMLDDEMLPGEEDL