Protein Info for AMB_RS20740 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 28 to 354 (327 residues), 272.6 bits, see alignment E=1.8e-85 PF16868: NMT1_3" amino acids 54 to 355 (302 residues), 253.1 bits, see alignment E=6.3e-79 PF09084: NMT1" amino acids 136 to 227 (92 residues), 29.6 bits, see alignment E=1e-10 PF12974: Phosphonate-bd" amino acids 156 to 232 (77 residues), 32.7 bits, see alignment E=8.5e-12

Best Hits

Swiss-Prot: 48% identical to BCSP_BRUAB: 31 kDa immunogenic protein (bcsP31) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K07080, (no description) (inferred from 100% identity to mag:amb4102)

Predicted SEED Role

"TRAP transporter solute receptor, TAXI family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZR9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>AMB_RS20740 hypothetical protein (Magnetospirillum magneticum AMB-1)
MIFVVYPLPVMRRFRGGKAAVPARMPIRSIVIAALLLLLTTGLGLAQDIRFFQIGTGPTG
ETRFAFGGLIANAISNPPGSRECDKGGSCGVPGMVAVAKSTGGAIANIDAIAAKRLDAAL
VQSDIAYWAYHGTGIYKGKGAVQNLRAIAMLYPESLHLVARKDAKIHSVKDLKGKRVSLG
DKDSGELVHGRLLLAAFGMTESQIKQSFLKPGPAADAVAAGQLDAMLVVDGLPVPIVSEL
AQRSDIVLIPLAGPEVDKMRATYPFFAASSIPADTYRGSDAEVKTLDVGVVLVTGAEQPN
DLIYGVTRALWHPSTQKLLTESHPRGKLVSLSAAGLDKLGIQLHGGASAYYFDAGVTH