Protein Info for AMB_RS20685 in Magnetospirillum magneticum AMB-1

Annotation: lipid A export permease/ATP-binding protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 187 (17 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 18 to 586 (569 residues), 610.9 bits, see alignment E=1.2e-187 PF00664: ABC_membrane" amino acids 32 to 297 (266 residues), 188 bits, see alignment E=2.9e-59 PF00005: ABC_tran" amino acids 364 to 513 (150 residues), 111.9 bits, see alignment E=3.7e-36

Best Hits

Swiss-Prot: 47% identical to MSBA_SYNAS: Lipid A export ATP-binding/permease protein MsbA (msbA) from Syntrophus aciditrophicus (strain SB)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 100% identity to mag:amb4090)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZT1 at UniProt or InterPro

Protein Sequence (595 amino acids)

>AMB_RS20685 lipid A export permease/ATP-binding protein MsbA (Magnetospirillum magneticum AMB-1)
MSKQKISFDHSTWVLVRRLFNEGMRPYMGKVMAAVFCMVVGAAANAGYALLMDPVVNKIF
TEKRPEFLLPLALAVLGTFAVKSVCNYGEAVFLSKVGLRVIADMQSRLFAHLMRLDVAFF
HANSTGRILSRLTNDISQMRFAVSDALTGAGKDASSVIFLIGAMFYQDWRLSAWTFFIFP
IAILPIRKLGRRMRKVTANTQEHMGQLTTYLEQAVQGIRVVKAYGMEEYEKRKVGALVEM
LQDLIYKAARVRSASSPIMELLGGIAITVVILYGGTRVVNGETTPGAFFSFITALMLAYR
PIKSLAAMNTNLQEGLAAASRTFSVLDTQPTIFEKDGAADLVVLEGNVSFEGVFFTYDGS
KAVLDGIDLAVPGGKTVALVGPSGAGKSTVLNLLPRFYDVTDGHVLVDGQDVRNVSLSSL
RSKIALVSQEITLFDDSIRANIAYGRFGATDEEIEAAARSAAAHDFIVSLPEGYDTVVGE
RGLNLSGGQRQRLAIARAMLKNAPILLLDEATSALDTESERQVQTALELLMRGRTTIVIA
HRLSTVVNADLIHVLDKGRVIESGDHNALMAKNGTYARLYAMQFAEEAVKAGSGG