Protein Info for AMB_RS20675 in Magnetospirillum magneticum AMB-1

Annotation: ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 13 to 48 (36 residues), 63.4 bits, see alignment 1e-21 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 16 to 184 (169 residues), 228.3 bits, see alignment E=6.1e-72 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 17 to 41 (25 residues), 22.7 bits, see alignment (E = 9e-09) PF00355: Rieske" amino acids 110 to 171 (62 residues), 34.7 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 63% identical to UCRI_RHORU: Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) from Rhodospirillum rubrum

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 100% identity to mag:amb4088)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZT3 at UniProt or InterPro

Protein Sequence (184 amino acids)

>AMB_RS20675 ubiquinol-cytochrome c reductase iron-sulfur subunit (Magnetospirillum magneticum AMB-1)
MADQAHNAQPSSVDGQTRRDFLLYATAGVGAIGTGLALWPFVHSMNPAADTLALSTTDVD
ISAIKPGQSVTVVWRGKPVFIRHREPAEIDEAGKVALADLREPQADADRAKKPEWLILIG
VCTHLGCVPLGQKPADPRGEFGGWFCPCHGSHYDTSGRIRKGPAPANLPVPPYQFTSDTT
VRIG