Protein Info for AMB_RS20625 in Magnetospirillum magneticum AMB-1

Annotation: GTPase ObgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 326 (324 residues), 458.8 bits, see alignment E=4.8e-142 PF01018: GTP1_OBG" amino acids 5 to 158 (154 residues), 212 bits, see alignment E=5.2e-67 PF01926: MMR_HSR1" amino acids 162 to 280 (119 residues), 91 bits, see alignment E=8.7e-30 PF02421: FeoB_N" amino acids 163 to 319 (157 residues), 49.8 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 100% identical to OBG_MAGSA: GTPase Obg (obg) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03979, GTP-binding protein (inferred from 100% identity to mag:amb4079)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZU2 at UniProt or InterPro

Protein Sequence (412 amino acids)

>AMB_RS20625 GTPase ObgE (Magnetospirillum magneticum AMB-1)
MKFLDQAKIFVKSGDGGAGCCSFRREKHIEFGGPDGGDGGRGGDVILECVANLNTLIDYR
YQQHFKAKIGNHGQGRNKTGGKGDDVILKVPVGTQVLDEEKETVLADLTSAGQTMVLLRG
GDGGFGNMHYKSSTNQAPRRADEGWPGEERWIWLRLKMIADAGLVGLPNAGKSTFLAAVT
RARPKIADYPFTTLHPNLGVVTLGEEEFVIADIPGLIEGAHEGAGIGDRFLGHIERCRVL
LHLIDGTQDDVAEAYRVVRHELAAYGGGLDEKPEVVALNKCDSLTADDIELKLMELSEAC
GQEVLPLSGVSGVGLKPILARLFTHIREAREAEPAVPAASPIFGSSKRGAPTFQQRKRKL
QAEDDEFAGGHWGADGEWIWHSADNDGDEVDEDYDDEDLEEVADDEEDDAEE