Protein Info for AMB_RS20600 in Magnetospirillum magneticum AMB-1
Annotation: 6-phosphofructokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to PFP_RHORT: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (pfp) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 100% identity to mag:amb4075)Predicted SEED Role
"Pyrophosphate-dependent fructose 6-phosphate-1-kinase (EC 2.7.1.90)" (EC 2.7.1.90)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
- homolactic fermentation (11/12 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- glycolysis IV (9/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
- 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
- superpathway of N-acetylneuraminate degradation (12/22 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.11
Use Curated BLAST to search for 2.7.1.11 or 2.7.1.90
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2VZU6 at UniProt or InterPro
Protein Sequence (404 amino acids)
>AMB_RS20600 6-phosphofructokinase (Magnetospirillum magneticum AMB-1) MLHGKVLVAQGGGPTAVINQSMVGAVLESRKFRNVDLVYGAHHGVRGIINEDFLDLTQET SHNLEMVAQTPSSALGSTRDKPDRKYCHEIFEVLRAHGIAYFFYIGGNDSSDTVRIVSEE AKAADYPLRCIHIPKTIDNDLVLNDHTPGFPSAARFVAQAFMGVNLDNAALRGVYLAVVM GRHAGFLTAASALGKKFPEDGPHLIYIPERTFRVESFLADVKAAYDKHGRCVVAISEGVH DEKGTPIVTTLSKATEKDAHGNIQLSGTGALSDLLCEEVKGKLGIKRVRGDTFGYLQRSF IGCVSDVDQREAREVGEKAVQFAMWGDQDGSVTIQRTGFYSVDYKLLPLASVAGKTRVME DHFIAESGTDVTDAFRMYLRPLLGSGMPDAFRLRLNSVPRILKK