Protein Info for AMB_RS20585 in Magnetospirillum magneticum AMB-1

Annotation: DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF04296: YlxR" amino acids 17 to 92 (76 residues), 71.2 bits, see alignment E=5.4e-24 PF01248: Ribosomal_L7Ae" amino acids 100 to 176 (77 residues), 22.1 bits, see alignment E=9.6e-09

Best Hits

KEGG orthology group: K07742, hypothetical protein (inferred from 100% identity to mag:amb4072)

Predicted SEED Role

"COG2740: Predicted nucleic-acid-binding protein implicated in transcription termination / ribosomal protein L7Ae family protein" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZU9 at UniProt or InterPro

Protein Sequence (198 amino acids)

>AMB_RS20585 DNA-binding protein (Magnetospirillum magneticum AMB-1)
MAESPDLDEEEEVGPERRCIVTGQVRPKSELLRFAVAPDGTLFPDPGHELPGRGIWLSAS
RDVVNTAVVKRSFARVARRQVVVPEDLADRVEALLARRCLDVLGLARRAGQAVCGFEKVC
AEIKARRAAVLLGARDAARDGRAKVQAMAPGVPAIELFDGAELGTVFGRDAAVHVCVLPG
RLAQRLKDGAALLAGFRG