Protein Info for AMB_RS20580 in Magnetospirillum magneticum AMB-1

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 872 PF08364: IF2_assoc" amino acids 18 to 55 (38 residues), 51.2 bits, see alignment (E = 4e-17) TIGR00487: translation initiation factor IF-2" amino acids 290 to 871 (582 residues), 816.5 bits, see alignment E=1.6e-249 PF04760: IF2_N" amino acids 295 to 345 (51 residues), 55.3 bits, see alignment 1.6e-18 TIGR00231: small GTP-binding protein domain" amino acids 373 to 527 (155 residues), 111.5 bits, see alignment E=3.6e-36 PF00009: GTP_EFTU" amino acids 376 to 532 (157 residues), 117.3 bits, see alignment E=2.3e-37 PF01926: MMR_HSR1" amino acids 376 to 482 (107 residues), 42.4 bits, see alignment E=2.5e-14 PF22042: EF-G_D2" amino acids 548 to 626 (79 residues), 97.9 bits, see alignment E=1.1e-31 PF11987: IF-2" amino acids 648 to 762 (115 residues), 144.7 bits, see alignment E=4e-46 PF03144: GTP_EFTU_D2" amino acids 793 to 860 (68 residues), 41.9 bits, see alignment 3.8e-14

Best Hits

Swiss-Prot: 92% identical to IF2_MAGSA: Translation initiation factor IF-2 (infB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 92% identity to mag:amb4071)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZV0 at UniProt or InterPro

Protein Sequence (872 amino acids)

>AMB_RS20580 translation initiation factor IF-2 (Magnetospirillum magneticum AMB-1)
MSDSQDQDRKAPLKLTQPGKLELKKTVETGQVRQSFSHGRSKVVTVEVRKKRTFTSAGGA
MHEIKDGVHSVAEADLAAAVAKVEAASRAASAHDLTTGEKAARAKALQDALRHEEEVRAR
AEEEAIRHAAEEEAARAAEEEAARLAEEEAARRAAEPQSEPEAAAPAAEPVAPTAPVAAA
PAPAPATPVAPAQPKPVAAAAPAGDATAVPRARTEEEEEEEERAKKRAAAHKPAPVKRTE
PRRRTGKLTITDALTDDDRSERGRSLAAVKRARERERLKHMQKGSEKVIREVIVPESITV
QELANRMAVRGADVIKCLMRLGVMATINQNIDADTAELVVTEFGHNMKRVSEADVLVGLE
GEADTDEVLFTRPPVVTVMGHVDHGKTSLLDALRATDVVSGEAGGITQHIGAYQVTMSSG
DKITFIDTPGHEAFTAMRARGAKVTDIVVLVVAADDGIMPQTVEAIRHAKAAGVPIIVAI
NKIDKPGATPEKVRQELLQHELVTEELGGDVLAIEVSAKKRLNLEKLEEAILLQAEILDL
KANPTRAAQGVVVEAKMEKGRGSVATVLVQKGTLKVGEVFVAGAEWGRVRALVDDHGNSI
KEAGPSTPVEVLGLQGTPAAGDDFVTVEDEARAREIAGYRSRMDREAKAKLAQRGTLEQM
FSAIKSGEAQELPVVIKGDVQGSIEAISSTLEKMGNENVKVRILHAAVGAINESDITLAK
ASNGLLIGFNVRANPQARDMARRDGVDIRYYSIIYDVTDDLKKMLSGMLAPELREKFLGY
ASIREVFNITKVGKVAGCMITEGTVKRGAKVRLLRDNVVIHTGDLGQLKRFKDDVKDVRE
GYECGMSFTNYEDIRVGDVIECFEIEEIAVTL