Protein Info for AMB_RS20525 in Magnetospirillum magneticum AMB-1

Annotation: adenylate/guanylate cyclase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 258 to 416 (159 residues), 47.5 bits, see alignment E=8.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4060)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZW1 at UniProt or InterPro

Protein Sequence (430 amino acids)

>AMB_RS20525 adenylate/guanylate cyclase domain-containing protein (Magnetospirillum magneticum AMB-1)
MITGIIDQPFPIRRLYLTRMIPALAVSALILLGGGWLSVTSLERRVYLETTQRRVENTVH
LVEKAEAETWARLVGGDNPAAVLSDPAGARARFLLEAVANDGHVFTLKIFNERGITLYAT
DSADVGVREENAVLRSVLRDRRPEIETTTRGDLSLYEIYVPVESGGHVIAFEVYEPSSVL
DDIIFDSFARFAVLPAVIMLAFGVWLYRVVSKAQADIDGRVTVQQNLRRQLERFVSQSAG
AAARLSPDGVVPTTRAGMTLFYSDVRDFSSLAEFHPPKATVDFLNELMTRQVEIVTAHGG
DVDKMIGDALLVRFEGSDREARALAAAQALLADLAARPMARSIGIGLYDGEAILGAIGPK
ERQDFTVIGDSVNLAARLCSLAEAGQLVIDELALRRSGLPETGFSAAEENKVKGRSGLVS
VRRWSPSTVA