Protein Info for AMB_RS20510 in Magnetospirillum magneticum AMB-1

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 28 to 434 (407 residues), 299.9 bits, see alignment E=1.5e-93 PF00529: CusB_dom_1" amino acids 167 to 417 (251 residues), 32.3 bits, see alignment E=1.2e-11 PF16576: HlyD_D23" amino acids 278 to 377 (100 residues), 31.1 bits, see alignment E=2.2e-11 PF13437: HlyD_3" amino acids 290 to 393 (104 residues), 51.4 bits, see alignment E=2.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4057)

Predicted SEED Role

"Secretion protein, HlyD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZW4 at UniProt or InterPro

Protein Sequence (461 amino acids)

>AMB_RS20510 HlyD family type I secretion periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MADGPMDSFRSPIHGIAPRLTPPSASWLLVWSALAFAVLVGGSAVLEIDEVVTAQARIEP
SSQVRHVQHFEGGTISEVLVHEGTLVAEGDVLVRLINSQGAGDLADKRARWAAFHARAAR
LRADLDNVAEIRWPRDVEIDAETRKRELAIHAERLSHRAQQATVISREIERRRREVVETE
TKVTGLSRAQAKGVEEMRIKRKAYDSGVVGNQEIVKLEREQLMLDTEVSTARDSISRLKA
QMSEAEARLSEFEKGWRAGVLDETGKVEAELSALRATMEVATDRESRSEIRSPVRGIVKM
SAIASVGQVARPGDTLMDIVPVDDALVVEAKVPPQDIGHLRPGLAASVRLSAYDQFRFGA
LPGHVVMVGADSFEETRGATTATYYKVQIRSDKTELLDGKGVAWPVRSGMAGTASIVIGS
KSILRMVLDPLLRNDMIFSLNSFRLDWPAWSDFSRTGKGAP