Protein Info for AMB_RS20335 in Magnetospirillum magneticum AMB-1

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF13432: TPR_16" amino acids 15 to 77 (63 residues), 32.8 bits, see alignment E=8.6e-11 amino acids 82 to 147 (66 residues), 23.5 bits, see alignment E=7.1e-08 amino acids 127 to 179 (53 residues), 24.6 bits, see alignment 3.2e-08 amino acids 152 to 210 (59 residues), 20 bits, see alignment 8.3e-07 amino acids 221 to 282 (62 residues), 24.9 bits, see alignment E=2.5e-08 amino acids 254 to 316 (63 residues), 29.8 bits, see alignment E=7.6e-10 PF13181: TPR_8" amino acids 46 to 76 (31 residues), 13.7 bits, see alignment (E = 6.5e-05) amino acids 148 to 179 (32 residues), 19.9 bits, see alignment (E = 6.7e-07) amino acids 183 to 214 (32 residues), 15.6 bits, see alignment (E = 1.6e-05) amino acids 252 to 281 (30 residues), 15.4 bits, see alignment (E = 1.8e-05) amino acids 289 to 316 (28 residues), 14 bits, see alignment (E = 5.1e-05) PF14559: TPR_19" amino acids 54 to 97 (44 residues), 26.5 bits, see alignment 6.8e-09 PF13424: TPR_12" amino acids 112 to 178 (67 residues), 30.9 bits, see alignment E=2.7e-10 PF13374: TPR_10" amino acids 149 to 177 (29 residues), 17.7 bits, see alignment (E = 3e-06) amino acids 215 to 242 (28 residues), 16.9 bits, see alignment (E = 5.3e-06) PF13176: TPR_7" amino acids 153 to 179 (27 residues), 14.3 bits, see alignment (E = 3.8e-05) PF13431: TPR_17" amino acids 170 to 201 (32 residues), 23.8 bits, see alignment (E = 3.8e-08) PF13174: TPR_6" amino acids 253 to 282 (30 residues), 14.1 bits, see alignment (E = 6.5e-05) PF07719: TPR_2" amino acids 285 to 316 (32 residues), 23.4 bits, see alignment (E = 4.6e-08) PF13489: Methyltransf_23" amino acids 363 to 487 (125 residues), 43.8 bits, see alignment E=2.5e-14 PF13649: Methyltransf_25" amino acids 384 to 473 (90 residues), 42.8 bits, see alignment E=7.2e-14 PF08241: Methyltransf_11" amino acids 385 to 477 (93 residues), 41.9 bits, see alignment E=1.4e-13 PF08242: Methyltransf_12" amino acids 385 to 475 (91 residues), 44 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4019)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W002 at UniProt or InterPro

Protein Sequence (540 amino acids)

>AMB_RS20335 SAM-dependent methyltransferase (Magnetospirillum magneticum AMB-1)
MSANSKPLNIGEAFGRAMAAWDDGNAAEARRLARSIVESKPDFGGAHYLLGLIALAQGQA
RRAAEHLTQAVAADPNQSVPRLALGRALEALDNYNSAILHYRAILSREPDHAEANARLAE
LLGRLGRNKAEALEHARRAVKVAPRHPEALCTLGTLLHQTGDHAEAARMLERSLEIRPDW
AVALNNYGLVLGSLGQYERAVAVLSGAAELRRDHAGTRANLAAALRGMGRLDEARLHAER
ATKINSRDMAGWLELGLVRKALGMPEAAAAAFERAVTAAPDSVHAHYCLAEARLVLGEKN
RAAKSFRRCLELDPEDRHGAALGLAQAGAGEAPARAPDAYVRQLFDDYADKFDAALVDKL
AYRAPALLAQAMDKALDRRQDLDVLDAGCGTGLAAPVLRPLAARLDGIDLSGAMVDKARA
RGLYDGLEVGELVAGLRHHPHAYDLVVAADVLVYFGGLEDIMAATALALKPGGVFAFTVE
RADDCASYVLGAKNRYAHAPEYVDAVAAANGFSVVSAERASTRQEAGEDVPGLVVVLRKG