Protein Info for AMB_RS20310 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF17159: MASE3" amino acids 42 to 269 (228 residues), 216.1 bits, see alignment E=1.5e-67 TIGR00229: PAS domain S-box protein" amino acids 275 to 399 (125 residues), 58.3 bits, see alignment E=4.2e-20 PF00989: PAS" amino acids 279 to 389 (111 residues), 41.7 bits, see alignment E=3.1e-14 PF13188: PAS_8" amino acids 279 to 331 (53 residues), 21.2 bits, see alignment 6.2e-08 PF08448: PAS_4" amino acids 285 to 393 (109 residues), 74.3 bits, see alignment E=2.7e-24 PF13426: PAS_9" amino acids 288 to 390 (103 residues), 33.9 bits, see alignment E=9.6e-12 PF02518: HATPase_c" amino acids 515 to 624 (110 residues), 84.9 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4013)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W008 at UniProt or InterPro

Protein Sequence (626 amino acids)

>AMB_RS20310 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MNRVEKDVLSLALPLLLLVAAAALCGLAVRIVPPGRIFDDPASYLAIHSALELISITVSL
MVFSLGWAVRRTDPNQRNLILGLAALAASAIDVFHTLSYAGMPDLVTPSSPEKAINLWLL
GRLAMAVGLVLAVIVTTDHQWRDATRRFWLGGVALVTTTLVAIGLVHPEWFPRTFIPGSG
LTPFKISAEYVLSVAYVGAASAMYLRFRRTGDPNELKLAAAAWIMALSGVLLTLYGDVGD
LFNLAGHLGKALAYLLIYGALFVSGVQTPYTALAKEQALLRTLMDSVPDLIFFKDPQSRY
LGYNRAFASYCGRPEAEMIGKTDDEFAPPEVAEFYRSKDRAAMAAGRPTTNEEWIDYPDG
RHVLLETIKAPIHENGGTLMGMVGISRDITRRSSAEEKLRRALSDLEMVTTVAAHDLQEP
ARTIASFLQLLELRYRGKLGEDADQYIAYAVAGAHRMRDQLAGLQEYTLVDQGPAFFPPV
DAAEIVAAILEAWKPKLDEAGAVVSLGSLPVVQANPDQLKALFQHLIGNALKFRHPDRPP
EIRLSAAHQGGTWEFSVTDNGIGVEEAYWDKIFMVFQRLHPLSLYEGTGIGLAICRKIVE
RHGGRIRVVSVPNQGSTFSFTIPDRA