Protein Info for AMB_RS20240 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 414 to 423 (10 residues), see Phobius details amino acids 484 to 509 (26 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 21 to 506 (486 residues), 467.6 bits, see alignment E=2.4e-144 PF07690: MFS_1" amino acids 25 to 418 (394 residues), 159.4 bits, see alignment E=5.8e-51

Best Hits

Swiss-Prot: 43% identical to EMRB_ACIBT: Colistin resistance protein EmrB (emrB) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 100% identity to mag:amb3999)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W022 at UniProt or InterPro

Protein Sequence (522 amino acids)

>AMB_RS20240 MFS transporter (Magnetospirillum magneticum AMB-1)
MTTPPLNPHDRVVTPRDWVGFMAMVVGMFMAILDIQIVASSIAQIQAGISASAEEISWVQ
TSYLIAEVVMIPLSGWLARVVSTRYLFFASCVTFTVASAACAVSWSIESMIAFRAIQGFL
GGAMIPTVFATSYMIFPPRQQATMSVVIGLTATMAPTIGPTLGGWLTETWSWHWLFLVNV
VPGVLVATLVYLFGRKEEPRLHMLKGFDMAGIALVAVFLGALQYVLEEGPGDDWFEDRRI
VLVSLISLLAGLGFVWRELTSEHPVVDLRAFSDSNFAVGCLYSFIIGIGLYGSVYVIPLY
LGRVRGYSALEIGLTMMVTGAFQALSAPLAGNLARHVDLRYMLGMGLALFGGGLWLNSAL
TSEWGYWEMFLPQAVRGLSLMFCFVPINAVALGHLPQDKVQNASGLYNLMRNLGGAIGLA
AINTALTHRLDLHLLRLSETLTAARGAATGMLEGLSARLQPLLDGGADRAALKLLSQLAR
REAMTMAFGDVLMLMAAVFALGLLLLPLLQPVRHPSAGGDGH