Protein Info for AMB_RS20200 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details PF00672: HAMP" amino acids 214 to 259 (46 residues), 39.2 bits, see alignment 7.1e-14 PF00015: MCPsignal" amino acids 364 to 527 (164 residues), 107.3 bits, see alignment E=8.2e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3991)

Predicted SEED Role

"InterPro IPR000727:IPR003660:IPR004089 COGs COG0840"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W030 at UniProt or InterPro

Protein Sequence (567 amino acids)

>AMB_RS20200 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MHSGLTIARLTNLFAVSLVAGFLAIMAAGYLAIGELKVGGPVYQRIVQGKDLVADILPPP
EYVIEAYLETNLALANPDSLPERKAALAKLRKEYDERHAYWLAQDMEAGLRDRLVVGAHA
PAMRLWAVIDQGFLPALERGEMDAARAAFAEISAAYAAHRAEIDEVVKGADKLTTDTEAY
AAQREQTFMLILWSVSGVVLAVTLAGVAGVIFGMVAPVKAMTGAMTALADGELSTRIPSV
RRGDEIGAMARAVEVFKENALKILQLRQDQAEAEARAKVEQRQSLHRMADDLENKVGEVI
GVVASAATQLQASAQGMSSVSEQTVRQSSAVAAASEQAAANVSTVAAASEELSASSREIG
SQVSLASAIAQDAASEAATTTDLVRGLAEAAGRIGDVVSLINDIASQTNLLALNATIEAA
RAGEAGKGFAVVANEVKTLANQTARATEEITAQINQVQDRTDQAVEAIANIARTIERMNE
ISGAIAVAVEEQGAATQEISRNIQQAHVGTSEVAGNIAGVSDGAQESNAAALHVLDAAGA
LHRQTDTLRGALGEFLSGVRAASASSC