Protein Info for AMB_RS20195 in Magnetospirillum magneticum AMB-1

Annotation: iron transporter MagA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 16 to 284 (269 residues), 280.3 bits, see alignment E=9.1e-88 PF00999: Na_H_Exchanger" amino acids 16 to 376 (361 residues), 188.6 bits, see alignment E=8e-60

Best Hits

Swiss-Prot: 100% identical to MAGA_MAGSA: Iron transporter MagA (magA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to mag:amb3990)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W031 at UniProt or InterPro

Protein Sequence (434 amino acids)

>AMB_RS20195 iron transporter MagA (Magnetospirillum magneticum AMB-1)
MELHHPELTYAAIVALAAVLCGGMMTRLKQPAVVGYILAGVVLGPSGFGLVSNRDAVATL
AEFGVLMLLFVIGMKLDIIRFLEVWKTAIFTTVLQIAGSVGTALLLRHGLGWSLGLAVVL
GCAVAVSSTAVVIKVLESSDELDTPVGRTTLGILIAQDMAVVPMMLVLESFETKALLPAD
MARVVLSVLFLVLLFWWLSKRRIDLPITARLSRDSDLATLSTLAWCFGTAAISGVLDLSP
AYGAFLGGVVLGNSAQRDMLLKRAQPIGSVLLMVFFLSIGLLLDFKFIWKNLGTVLTLLA
MVTLFKTALNVTALRLARQDWPSAFLAGVALAQIGEFSFLLAETGKAVKLISAQETKLVV
AVTVLSLVLSPFWLFTMRRMHRVAAVHVHSFRDLVTRLYGDEARAFARTARRARVLVRRG
SWRDDPNAGPGSGI