Protein Info for AMB_RS20095 in Magnetospirillum magneticum AMB-1

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 10 to 204 (195 residues), 259.1 bits, E=1.1e-81
• PF07021: MetW
  • amino acids 10 to 204 (195 residues), 273.8 bits, E=1.9e-85
• PF13489: Methyltransf_23
  • amino acids 21 to 110 (90 residues), 38.9 bits, E=1.8e-13
• PF13847: Methyltransf_31
  • amino acids 22 to 112 (91 residues), 32.5 bits, E=1.7e-11
• PF13649: Methyltransf_25
  • amino acids 26 to 110 (85 residues), 32.8 bits, E=2.3e-11
• PF08241: Methyltransf_11
  • amino acids 27 to 111 (85 residues), 35.2 bits, E=4.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3971)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

See Q2W050 at UniProt or InterPro

Protein Sequence (208 amino acids)

>AMB_RS20095 methionine biosynthesis protein MetW (Magnetospirillum magneticum AMB-1)
MMTVANGNLRVDLRLIADMVEPGSRVLDVGCGEGALLDWLGRTKNVDGRGIELSMAGVSA
AVSHGLSVIQGDADTDLKDYPSGAFDYVILSQTLQATYAPRTVLSHMLRIGRRAIVSFPN
FGHWRVRLHLLTHGRMPVTDTLAYEWYDTPNIHFCTIRDFLDLCRDLQIKVERSIPLDRG
GKTMAIPSCEGIANLFADQGLFVLSREG