Protein Info for AMB_RS20060 in Magnetospirillum magneticum AMB-1

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF02627: CMD" amino acids 36 to 121 (86 residues), 83.6 bits, see alignment E=4e-28

Best Hits

Swiss-Prot: 38% identical to DC4C_ACIAD: 4-carboxymuconolactone decarboxylase (pcaC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 100% identity to mag:amb3965)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W056 at UniProt or InterPro

Protein Sequence (133 amino acids)

>AMB_RS20060 4-carboxymuconolactone decarboxylase (Magnetospirillum magneticum AMB-1)
MTQVHDTRYQRGLAALSAIDGEAGEKVVAQLADIAPDFARYLIEFPFGDIYSRPGLDLRS
REIATIAALAALGNAQPQLKVHITAALNVGVTRDEIVEILMQIAVYAGFPAALNALFAAK
EVFSSHPPSGAAQ