Protein Info for AMB_RS20050 in Magnetospirillum magneticum AMB-1

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF07992: Pyr_redox_2" amino acids 6 to 331 (326 residues), 251.9 bits, see alignment E=4e-78 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 6 to 468 (463 residues), 589.4 bits, see alignment E=2.3e-181 PF01134: GIDA" amino acids 7 to 81 (75 residues), 28.8 bits, see alignment E=3e-10 PF12831: FAD_oxidored" amino acids 7 to 52 (46 residues), 36.4 bits, see alignment 1.8e-12 PF00890: FAD_binding_2" amino acids 7 to 43 (37 residues), 31.2 bits, see alignment 6.2e-11 PF13450: NAD_binding_8" amino acids 10 to 46 (37 residues), 26 bits, see alignment 4.2e-09 PF13738: Pyr_redox_3" amino acids 134 to 315 (182 residues), 32.8 bits, see alignment E=2.1e-11 PF00070: Pyr_redox" amino acids 178 to 254 (77 residues), 76.5 bits, see alignment E=8.5e-25 PF02852: Pyr_redox_dim" amino acids 350 to 458 (109 residues), 138.1 bits, see alignment E=6e-44

Best Hits

Swiss-Prot: 62% identical to DLDH_PEA: Dihydrolipoyl dehydrogenase, mitochondrial (LPD) from Pisum sativum

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mag:amb3963)

MetaCyc: 60% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W058 at UniProt or InterPro

Protein Sequence (469 amino acids)

>AMB_RS20050 dihydrolipoyl dehydrogenase (Magnetospirillum magneticum AMB-1)
MSDTSFDVVIIGGGPGGYVAAIRAAQLGLKTACIEKRGSLGGTCLNVGCIPSKALLTASH
HYHAAAHELGSFGIKVAKVEMDVAGMMGHKDKVVSDNTKGIEFLFKKNKVTYIVGAGAIT
APGQIEVTAKDGAKSNVAAKHIVIATGSDVTPLPGVEIDEEVIISSTGALALSKTPKHMV
VIGGGVIGLELGTVWGRLGAKVTVVEFLDRILPFNDGEVSKQMQRLLAKQGMEFKLGTKV
TGIAKKGKTATVTVEPAAGGAAEKIEADSVLVAIGRKPYTEGLGLDKVGVALDKRGFVQI
DGHFRTNVPGIYAIGDVVGGAMLAHKAEEEGVALAEILAGQHGHVNYEAIPAVVYTWPEV
ASVGKTEEQLKAEGIAYKAGKFPFTANGRARSMNEVDGFVKVLACATTDKVLGAHIVGPN
AGDLIAEVVLAMEFGAASEDIARTCHAHPGLGEAVKEACLAVDGRPLHT