Protein Info for AMB_RS20050 in Magnetospirillum magneticum AMB-1

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 6 to 468 (463 residues), 589.4 bits, E=2.3e-181
• PF07992: Pyr_redox_2
  • amino acids 6 to 331 (326 residues), 251.9 bits, E=4.4e-78
• PF12831: FAD_oxidored
  • amino acids 7 to 54 (48 residues), 36.4 bits, 2e-12
• PF00890: FAD_binding_2
  • amino acids 7 to 43 (37 residues), 31.2 bits, 6.9e-11
• PF01134: GIDA
  • amino acids 7 to 81 (75 residues), 28.8 bits, E=3.3e-10
• PF13450: NAD_binding_8
  • amino acids 10 to 46 (37 residues), 26.4 bits, 3.4e-09
• PF13738: Pyr_redox_3
  • amino acids 134 to 315 (182 residues), 32.7 bits, E=2.5e-11
• PF00070: Pyr_redox
  • amino acids 178 to 254 (77 residues), 76.4 bits, E=1e-24
• PF02852: Pyr_redox_dim
  • amino acids 350 to 458 (109 residues), 138.1 bits, E=6.6e-44

Best Hits

Swiss-Prot: 62% identical to DLDH_PEA: Dihydrolipoyl dehydrogenase, mitochondrial (LPD) from Pisum sativum

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mag:amb3963)

MetaCyc: 60% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• photorespiration I (7/9 steps found)
• glycine degradation (2/3 steps found)
• folate transformations I (9/13 steps found)
• photorespiration III (6/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• photorespiration II (6/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

See Q2W058 at UniProt or InterPro

Protein Sequence (469 amino acids)

>AMB_RS20050 dihydrolipoyl dehydrogenase (Magnetospirillum magneticum AMB-1)
MSDTSFDVVIIGGGPGGYVAAIRAAQLGLKTACIEKRGSLGGTCLNVGCIPSKALLTASH
HYHAAAHELGSFGIKVAKVEMDVAGMMGHKDKVVSDNTKGIEFLFKKNKVTYIVGAGAIT
APGQIEVTAKDGAKSNVAAKHIVIATGSDVTPLPGVEIDEEVIISSTGALALSKTPKHMV
VIGGGVIGLELGTVWGRLGAKVTVVEFLDRILPFNDGEVSKQMQRLLAKQGMEFKLGTKV
TGIAKKGKTATVTVEPAAGGAAEKIEADSVLVAIGRKPYTEGLGLDKVGVALDKRGFVQI
DGHFRTNVPGIYAIGDVVGGAMLAHKAEEEGVALAEILAGQHGHVNYEAIPAVVYTWPEV
ASVGKTEEQLKAEGIAYKAGKFPFTANGRARSMNEVDGFVKVLACATTDKVLGAHIVGPN
AGDLIAEVVLAMEFGAASEDIARTCHAHPGLGEAVKEACLAVDGRPLHT