Protein Info for AMB_RS20005 in Magnetospirillum magneticum AMB-1

Annotation: succinate dehydrogenase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF13085: Fer2_3" amino acids 29 to 128 (100 residues), 114.7 bits, see alignment E=4e-37 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 31 to 251 (221 residues), 269.8 bits, see alignment E=8.1e-85 PF13237: Fer4_10" amino acids 169 to 238 (70 residues), 25.6 bits, see alignment E=1.8e-09 PF13183: Fer4_8" amino acids 169 to 241 (73 residues), 32.7 bits, see alignment E=1.7e-11 PF13534: Fer4_17" amino acids 169 to 242 (74 residues), 39.3 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 73% identical to SDHB_RICBR: Succinate dehydrogenase iron-sulfur subunit (sdhB) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to mag:amb3953)

MetaCyc: 66% identical to succinate dehydrogenase [ubiquinone] iron-sulfur subunit (Homo sapiens)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W068 at UniProt or InterPro

Protein Sequence (259 amino acids)

>AMB_RS20005 succinate dehydrogenase iron-sulfur subunit (Magnetospirillum magneticum AMB-1)
MVEFALPPNSRVQPGKVYKAVGAKNVKVFKIYRYDPDANANPRLDSYEIDLDACGPMVLD
ALLKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACLKPIEDIKGEAAIYPLPHMPV
VKDLIPDLTLPYAQLASIKPWMQTQTAPPPDGERLQSPEEREKLDGLWECILCFCCQTSC
PSYWWNGDRYLGPSVLLQAARWILDSRDEMTGERLDDLEDPFKLYRCHTIMNCTKTCPKG
LNPAKAIGAIKEKIMERRV