Protein Info for AMB_RS19860 in Magnetospirillum magneticum AMB-1

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 65 to 91 (27 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details PF01595: CNNM" amino acids 15 to 193 (179 residues), 141.5 bits, see alignment E=3.6e-45 PF00571: CBS" amino acids 208 to 265 (58 residues), 33.1 bits, see alignment E=8.7e-12 amino acids 282 to 331 (50 residues), 35.7 bits, see alignment 1.4e-12 PF03471: CorC_HlyC" amino acids 348 to 422 (75 residues), 77.1 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3924)

Predicted SEED Role

"Co2 transporter containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W097 at UniProt or InterPro

Protein Sequence (430 amino acids)

>AMB_RS19860 HlyC/CorC family transporter (Magnetospirillum magneticum AMB-1)
MLDQGPLFLTLSVIAIVVLQAGSAFFAGTETALTAVSRPVMHQLEQDGSAPARRVNRLID
ARQRLIGALLIGNSLTHTLSSSLATGVLVGLFGDAGIAYASAGMTVIIVVFGEVLPKTYA
IYHANRMALLFSAPVTGVVWILTPFVRTVEVVVMGLFRLFGAKYSTAVSVEASMMELKGA
IEVHAGEEEVREERRMLRSILELGDVEVEQVMTHRRGVVTADAGLPAAEILELVVSSPFS
RVPLWKDDPDNIVGVVHAKDLLRAVRALDGELDKLDVVELASPPWFIPDSTTLLEQLQAF
RSRREHFALVVDEYGTLMGVVTLEDILEEIVGDIADEHDVAVAGVRPQSDGSYIVDGSVT
IRDLNREFEWRLPDEEAATIAGLILHEARQIPDVGQVFRFYGFRFEIARRQRNQITSIRV
MPPAPAPSVT