Protein Info for AMB_RS19815 in Magnetospirillum magneticum AMB-1

Annotation: cobaltochelatase subunit CobS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF12556: CobS_N" amino acids 14 to 46 (33 residues), 63.2 bits, see alignment 2.1e-21 TIGR01650: cobaltochelatase, CobS subunit" amino acids 16 to 330 (315 residues), 619 bits, see alignment E=9.3e-191 PF07728: AAA_5" amino acids 73 to 197 (125 residues), 43.8 bits, see alignment E=4e-15 PF00004: AAA" amino acids 74 to 152 (79 residues), 21.9 bits, see alignment E=3.1e-08

Best Hits

Swiss-Prot: 76% identical to COBS_SINSX: Aerobic cobaltochelatase subunit CobS (cobS) from Sinorhizobium sp.

KEGG orthology group: K09882, cobaltochelatase CobS [EC: 6.6.1.2] (inferred from 100% identity to mag:amb3915)

MetaCyc: 76% identical to CobS (Pseudomonas denitrificans (nom. rej.))

Predicted SEED Role

"Aerobic cobaltochelatase CobS subunit (EC 6.6.1.2)" in subsystem Coenzyme B12 biosynthesis or Conenzyme B12 related Hypothetical: Clusters with cobST (EC 6.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.6.1.2

Use Curated BLAST to search for 6.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0A6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>AMB_RS19815 cobaltochelatase subunit CobS (Magnetospirillum magneticum AMB-1)
MTSKIQSPLASDHPLAMPDTEISAREVFGIDLDMKVPAFSVGSEHVPDVDPAYRFDPDTT
KAILAGFAFNRRVMVQGYHGTGKSTHIEQVAARLNWPCIRVNLDSHVSRIDLIGKDAIVV
KDGKQITEFREGMLPWALQHPCALVFDEYDAGRPDVMFVIQRVLEVEGRLTLLDQNRVIR
PHAAFRLFATANTVGLGDTTGLYHGTQQINQGQMDRWNIVATLNYLAHDDECSIVVAKLK
DYDSPEGRDLVSKMVMLADLTRQGFMNGDISTVMSPRTVITWAENARIFGDHSYAFRVTF
LNKCDEVERPILAEYYQRCFGTDLPDGPARMLA