Protein Info for AMB_RS19775 in Magnetospirillum magneticum AMB-1

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 78 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details PF01569: PAP2" amino acids 91 to 221 (131 residues), 72.8 bits, see alignment E=2.3e-24 PF14378: PAP2_3" amino acids 147 to 212 (66 residues), 29.6 bits, see alignment E=5.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3907)

Predicted SEED Role

"Phosphoesterase, PA-phosphatase related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0B4 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AMB_RS19775 phosphatase PAP2 family protein (Magnetospirillum magneticum AMB-1)
MGSAVFRNPWTWVLAALVPLTLFPQIDLAASALFFDAQARGFPFRVHPIGEFARKILPIF
LFTAAGLIALAGAAAAILKRPVAGIRPPMALLVVGSLALGPGLVVNVILKDYWGRARPST
IAEFNAGHQPDRRYTPPLIISDQCPDNCSFPSGHAALGFWTVSLALIAPPRRRRAAFAAA
LAFGLAMGAVRIAQGGHFLSDVAYSGAIVVGLTMGLYRIIRRHDRSAAQKNNYQEPLRGP