Protein Info for AMB_RS19760 in Magnetospirillum magneticum AMB-1

Annotation: electron transfer flavoprotein subunit beta/FixA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF01012: ETF" amino acids 26 to 206 (181 residues), 151.1 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 74% identical to ETFB_BRADU: Electron transfer flavoprotein subunit beta (etfB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to mag:amb3230)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0B7 at UniProt or InterPro

Protein Sequence (249 amino acids)

>AMB_RS19760 electron transfer flavoprotein subunit beta/FixA family protein (Magnetospirillum magneticum AMB-1)
MKILVAIKRVIDYNVKIRVKSDGSGVETQNVKFSMNPFDEIAVEEAVRLKEAGKATEVVV
VSIGPAAASETLRTALAMGADRGVLVQTDDEVQPLGVAKVLKALVAKEAPGLIILGKQAI
DDDSNQTGQMLAALLGCAQGTFASKVEIGADAITVTREVDGGLETVSLKLPAVVTTDLRL
NEPRYASLPNIMKAKKKPIDTVSPADLGVDVAPRLVTLSVAEPPKRSAGIKVADVAALVD
KLKNEAKVI