Protein Info for AMB_RS19745 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details PF02203: TarH" amino acids 4 to 173 (170 residues), 64.4 bits, see alignment E=2.6e-21 PF12729: 4HB_MCP_1" amino acids 5 to 184 (180 residues), 57 bits, see alignment E=3.9e-19 PF00672: HAMP" amino acids 209 to 256 (48 residues), 35.8 bits, see alignment 1.7e-12 PF00015: MCPsignal" amino acids 365 to 521 (157 residues), 107 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3901)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0C0 at UniProt or InterPro

Protein Sequence (562 amino acids)

>AMB_RS19745 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MSFHWTITRKLQAMTVLMLLLLTATSGFGILGMSRMHDGFRAVTEDTTPALIHLSGTVDA
LHRIRVRVIGAAMETDSARIAALRDEYVKQLADLNKTWNAYAASRLSPEEAALAREAETG
IKSYQGFIQESWARIAAGEANGVLADLVGGKGVDKFREAATPLRKLLDFQSREAATMFAE
GEQNYDRDRSASLGLVGLGLVLGFALSALIGRSVARPIHRIIAVMGRLAANDTQVEVTGQ
DRGDEVGEIARAVQVFKLNALEKGRLEAEAQENKRLAESRHHQEMKSLAADFESGVSVVV
DKVAGASAEMEHTAQALSTLSEQVAVRAEEVAGASEHAAANVETVAAATEELAASVAEIG
RQVSESARVARDAVDEAAQANTIVHGLSEATKRIGEVVTMITDIAAQTNLLALNATIEAA
RAGEAGKGFAVVAGEVKNLANQTARATDEISQQIASVQAETGRAVDAIRGVGTTIGRIDE
ISAAIASAVEEQGAATREIARNVEEAAQGTQSVSGNIAGVTSAARDTGQASATVLASATE
LAAEAHTLRRIVQDFVAKVRAS