Protein Info for AMB_RS19735 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 283 to 302 (20 residues), see Phobius details PF14827: dCache_3" amino acids 38 to 268 (231 residues), 137.3 bits, see alignment E=1.4e-43 PF00672: HAMP" amino acids 300 to 351 (52 residues), 41.7 bits, see alignment 2.4e-14 PF00015: MCPsignal" amino acids 455 to 623 (169 residues), 128.3 bits, see alignment E=5.8e-41 PF13682: CZB" amino acids 669 to 735 (67 residues), 52 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3899)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0C2 at UniProt or InterPro

Protein Sequence (775 amino acids)

>AMB_RS19735 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MGFGIAARFGAALVAMSVGTAATMGWFSNNHAVTLIEQAEQRELMGRFEQLSDAIGGSAD
QAQAMAALVANLPGIPHLVATGSRDALAAQMVPVFKAMAQPFGIEQFQFHTPPATSFLRA
HSPAKFGDDLSAIRQTVVETNATQKPTHGLEYGVAGLGVRGLMPLFDEGRHIGSVEFGLS
FGPPFFTEFKKSFGVDVALHVKAKDQFKVFAGTIAQSALEPAEIAAALGGRDIIKAVEDG
KGGRTAVLGRAVKDYSGKPLGVAEIAMDASHYAAQLAEARRTMAGLILGAILVSIVLSVL
LSRTITRPVLAMSAAMDRIAKRDFAVDIHGLDRNDEIGHMARAVEVVQKEVERTAELEVA
QQRNLVELEKGQKSLKDGMQLQLEGIVEAAMQSNEAGVVLARMSGSVRRASEQSQSIASA
IEQLVASVGTIAQSSEIAAGEASDAEAAAKEGVSATAAARRAMDGLLEAVSDVGGKIEAL
SNASDQIAAIIDQIEAIAGQTNLLALNATIEAARAGEAGKGFAVVAGEVKTLANQTAKAT
VDIRARIEGLVSDMNGARASMERSRGAANDGMAAVGQVTGGLEAIAGRIDGVTRRMHDIA
GILSQQNAAATEVSSATGEIASLSEHNLEEIAQVLGAMTEAASVLDRRAEDFAKLGTSET
LLQVAKNDHIRFKRSIIDRIMGRNDLTPDRLADHHTCRLGKWYDTLKDDRLTGLGAYGRL
LDPHQRVHAHGKRALELHARGETLAAMAEVDLLNQASHEVLTLLEEMAQALRAAA