Protein Info for AMB_RS19720 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF00672: HAMP" amino acids 33 to 81 (49 residues), 28.2 bits, see alignment 2e-10 PF00015: MCPsignal" amino acids 183 to 348 (166 residues), 108.3 bits, see alignment E=4.1e-35

Best Hits

Predicted SEED Role

"InterPro IPR000727:IPR003660:IPR004089 COGs COG0840"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>AMB_RS19720 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MDRVRSAKLRLSILITVAGIGLIGAMASLIGKRTIAAPIDAMAAAMDKLRQRDYGVHIPG
VGLTNEIGRMASSLAVFRDAMVETERLTAEHEAELTERVERGRAMDSLARDFDRTVSGVL
EVVSGAATELHATAQGMQTIAEQTQDKATAVAAAAEEASSSVETVATAAEELSASIAEIA
RQVAQSSTAAQQASDEARQTNTIVQGLAASSTRIGDVVSLINDIAAQTNLLALNATIEAA
RAGEAGKGFAVVAGEVKALANQTGKATEEISTQVGAVQTATREAVAAIGSIVGRIEEINH
IATAISAAVEEQSAATAEIARNVDQASQGTRQVSANVGGVSATAAETDAAAVQVLSAAQS
LSREATELKDVVDRFLEGVRTVQG