Protein Info for AMB_RS19710 in Magnetospirillum magneticum AMB-1

Annotation: pyrimidine 5'-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00702: Hydrolase" amino acids 13 to 185 (173 residues), 62 bits, see alignment E=1.6e-20 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 13 to 189 (177 residues), 195.9 bits, see alignment E=5.2e-62 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 14 to 191 (178 residues), 54.7 bits, see alignment E=1.3e-18 PF13419: HAD_2" amino acids 92 to 191 (100 residues), 37.2 bits, see alignment E=4.6e-13 PF13242: Hydrolase_like" amino acids 147 to 219 (73 residues), 24.6 bits, see alignment E=2.9e-09

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to mag:amb3895)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0C6 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AMB_RS19710 pyrimidine 5'-nucleotidase (Magnetospirillum magneticum AMB-1)
MDKDFPDLSRIETWVFDLDNTLYPASSSLFPQIDVRMRRFIADRLHLSLDDAYALQKRYY
KEFGTTLRGLMLVHKIEPEAFLSFVHDIDCTVLDAAPRLDAALAALSGRKLIFTNGSERH
AENVLARLGLARHFEGIFDIRAARFIPKPQPECYRLMIDRHGVDPHAALMVEDIHRNLRP
AADIGMTTLWVKEDGHPDTEVLGQDAGDLSHVHHITDDLAAWLELAARP