Protein Info for AMB_RS19695 in Magnetospirillum magneticum AMB-1

Annotation: ferredoxin--NADP(+) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF07992: Pyr_redox_2" amino acids 7 to 295 (289 residues), 86.6 bits, see alignment E=5.3e-28 PF13738: Pyr_redox_3" amino acids 85 to 288 (204 residues), 57.4 bits, see alignment E=3.8e-19 PF00743: FMO-like" amino acids 112 to 185 (74 residues), 22.9 bits, see alignment E=7.2e-09 PF00070: Pyr_redox" amino acids 155 to 230 (76 residues), 35.7 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 100% identical to FENR_MAGSA: Ferredoxin--NADP reductase (amb3892) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to mag:amb3892)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0C9 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AMB_RS19695 ferredoxin--NADP(+) reductase (Magnetospirillum magneticum AMB-1)
MAQHETDAVIVGAGPVGLFAVFQCGMVKVRCHVVDALEAVGGQLSALYPEKPIYDIPGHP
SILAADLVERLSEQAAPFAPTYHFGTQVSTLSRLDDGRWLCGLSNGDSIAARAVIICAGG
GAFGPNRPPLDGLEQFEGTGVFYLVRKREDFRGKKVVIAGGGDSAVDWAISLSEVAAKVM
VVHRRPKFRAAPESEARLKQLAETGAVELVVPYQLHGLEGENGTLSAVVVATLEGETKSL
PADVLLPFYGLSSDLGPIAQWNLGMDRNLIAVDPATGATDAPGIYAAGDICTYPGKLKLI
LSGFAEAARVAHSAHDVVHPGEALHFEHSTTSGVPKG