Protein Info for AMB_RS19660 in Magnetospirillum magneticum AMB-1

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 11 to 315 (305 residues), 384.3 bits, E=2e-119
• PF02445: NadA
  • amino acids 15 to 313 (299 residues), 399 bits, E=5.7e-124

Best Hits

Swiss-Prot: 60% identical to NADA_MICAN: Quinolinate synthase A (nadA) from Microcystis aeruginosa (strain NIES-843)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to mag:amb3886)

MetaCyc: 42% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See Q2W0D5 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AMB_RS19660 quinolinate synthase NadA (Magnetospirillum magneticum AMB-1)
MTEADIDPTLDLVAEIDRLRKERNAVILAHYYQEGEIQDLADFVGDSLDLSRKAAATDAD
MIVFCGVRFMGEVAKILSPSKLVVIPDSEAGCSLEESCRPEPFRAFREKHPDHIAVTYIN
CSAEVKALSDVIVTSSNAEAIISQLPADRPILFAPDRHLGAYMQKKTGRDMTLWPGSCII
HEQFSEKELVKLKVRHPKALVAAHPECPDSILNHADHVGSTRNILDFVLASSAKEFIIAT
EQHIIHQMSKAAPDKTFIPAPGADGGCSCSNCPFMARNTLEKIYLCLKNDAPAITVPEDL
RVAALKPLERMLEMSKSVPMSGDKPNAA