Protein Info for AMB_RS19575 in Magnetospirillum magneticum AMB-1

Annotation: Mg2+/Co2+ transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details PF01544: CorA" amino acids 24 to 322 (299 residues), 165.6 bits, see alignment E=7.8e-53

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to mag:amb3869)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0F2 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AMB_RS19575 Mg2+/Co2+ transporter (Magnetospirillum magneticum AMB-1)
MITTYHAKDGAVIVGGADGVSRDALWLDLLDPSAEEIALVEARTGLDLPSRDRMEEIEAS
SRLSRHGDALMMTVPVLTGAGGSEPRNSAVTFILSQSLLVTLRHGTPRAIATFSQDLPQA
SPAPANGGDVLLGLVEAIVDRIADVLQDLGAGLDVISHRIFHQPTGNHHRRRRAGSREME
ALLRTIGRTGDLSGKARETLVGLKRVIAFLPHGAGALGLGNAPERLRSIDQDLHSLAEYT
DFLGNKINFLLDATLGLIGIQQNQVIKLFTIMSVLFLPPTLVASWYGMNFKIIPELQWEW
GYAYAIALAVLSAVVPYLFFRRKGWV