Protein Info for AMB_RS19510 in Magnetospirillum magneticum AMB-1

Annotation: UDP-3-O-acyl-N-acetylglucosamine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  • amino acids 59 to 346 (288 residues), 330.5 bits, E=4.9e-103
• PF03331: LpxC
  • amino acids 61 to 334 (274 residues), 358.8 bits, E=1e-111

Best Hits

Swiss-Prot: 100% identical to LPXC_MAGSA: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 100% identity to mag:amb3855)

MetaCyc: 38% identical to UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (Helicobacter pylori 26695)
RXN-22247 [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (10/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (10/25 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

See Q2W0G6 at UniProt or InterPro

Protein Sequence (365 amino acids)

>AMB_RS19510 UDP-3-O-acyl-N-acetylglucosamine deacetylase (Magnetospirillum magneticum AMB-1)
MIDLSPGRRRGTPFTIRFKDRKAPYDTSGAAAQETGVFSVNQIVSHLRPEAKSSTSHSMR
QRTLKSAIGCTGVGLHSGAKVTMVLHPAEAGTGIRFRRVDIAGGGAIVPALWSSVGDTRM
NTCLKNEAGVVVGTVEHLMSALAGMQIDNCLIEINGPEVPVMDGSAAPFLFLIECAGVVE
QEAPRQAIKILKRVAIKDGERTASLTPSSGFSVRFEIDFGASAISRQEFFVNLTRGTFKA
EVSRARTFGFEQEVAMLRAHGLARGGSLDNAVVIDSTGTKVLNDDGLRYQDEFVRHKVLD
AVGDLYLAGAPLLGHYHGVRAGHAVTNQLLRALFADATAWELTTIAPGSAAAPFAAQPLA
IAANG